You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330140 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IGF2BP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 63kDa |
Target | IGF2BP1 |
UniProt ID | Q9NZI8 |
Protein Sequence | Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT |
NCBI | NP_006537 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CRD-BP antibody, anti CRDBP antibody, anti IM Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Lung tissue using IGF2BP1 antibody
Western blot analysis of HepG2 cell lysate tissue using IGF2BP1 antibody
Immunohistochemical staining of human lung adenocarcinoma tissue using IGF2BP1 antibody
Host: Rabbit, Target Name: IGF2BP1, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Host: Rat, Target Name: IGF2BP1, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP, Secondary antibody Dilution: NOT FOUND.
Sample Type: Human lung adenocarcinoma, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody Dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.
WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating