Ift88 antibody

• Catalog Number: orb582172
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Ift88
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 89kDa
• Target: Ift88
• UniProt ID: D4ACI9
• Protein Sequence: Synthetic peptide located within the following region: MMENVHLAPETDEDDLYSGFNDYNPAYDTEELENDTGFQQAVRTSHGRRP
• NCBI: 157821925, B5WUVB49013, NP_001100736
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Ttc10
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: IFT88, Sample Tissue: Rat Rat Spleen, Antibody dilution: 5 ug/ml.

Immunohistochemistry with Testis tissue.

WB Suggested Anti-Ift88 Antibody Titration: 1 ug/ml, Positive Control: Rat Brain lysate.