You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588971 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IFITM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IFITM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14 kDa |
Target | IFITM1 |
UniProt ID | P13164 |
Protein Sequence | Synthetic peptide located within the following region: HKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCC |
NCBI | NP_003632.3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | 9-27, CD225, IFI17, LEU13, DSPA2a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: IFITM1, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: IFITM1, Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/ml.
ELISA, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
ELISA, IF, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating