You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579632 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IFIT3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IFIT3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56 kDa |
Target | IFIT3 |
UniProt ID | O14879 |
Protein Sequence | Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY |
NCBI | NP_001026853 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P60, IRG2, IFI60, IFIT4, ISG60, RIG-G, cig41, CIG- Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: IFIT3, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.
Human kidney
WB Suggested Anti-IFIT3 Antibody Titration: 0.25 ug/ml, Positive Control: HepG2 cell lysate.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating