You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575983 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IFIH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IFIH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 117kDa |
Target | IFIH1 |
UniProt ID | Q9BYX4 |
Protein Sequence | Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED |
NCBI | NP_071451 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.
Lanes: 1: 20 ug HEK293T no transfection, 2: 20 ug HEK293T 3Flag-MDA5/IFIH1, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:1000, Gene Name: IFIH1, IFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating