IDH1 antibody

• Catalog Number: orb330780
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IDH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: IDH1
• UniProt ID: O75874
• Protein Sequence: Synthetic peptide located within the following region: VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
• NCBI: NP_005887
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti IDH antibody, anti IDP antibody, anti PICD an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Fetal liver cell lysate tissue using IDH1 antibody

Immunohistochemical staining of human Testis tissue using IDH1 antibody

Immunohistochemical staining of human Testis tissue using IDH1 antibody

Western blot analysis of human HepG2 tissue using IDH1 antibody

Western blot analysis of human MCF7 tissue using IDH1 antibody

Host: Rabbit, Target Name: IDH1, Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.

Host: Rabbit, Target Name: IDH1, Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in MCF7.

Host: Rat, Target Name: IDH1, Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Human Testis

Human Testis

WB Suggested Anti-IDH1 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate.