IDH1 antibody

• Catalog Number: orb330779
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IDH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Yeast
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: IDH1
• UniProt ID: O75874
• Protein Sequence: Synthetic peptide located within the following region: MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG
• NCBI: NP_005887
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti IDH antibody, anti IDP antibody, anti PICD an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Testis tissue using IDH1 antibody

Immunohistochemical staining of human glioma tissue using IDH1 antibody

Immunohistochemical staining of human Testis tissue using IDH1 antibody

Western blot analysis of human HepG2, Drosophila tissue using IDH1 antibody

Western blot analysis of human HepG2 tissue using IDH1 antibody

Host: Rat, Target Name: IDH1, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

Sample type: 1. HEPG2 (50 ug), 2. Drosophila extract (50 ug), Primary dilution: 1:1000, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:5000.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

IDH1 antibody - C-terminal region (orb330779) validated by WB using HEPG2 lysate + Drosophila extract at 1:1000. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.

Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

Sample Type: Human glioma cells, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: 1. Red: Nucleus 2. Green: IDH 3. Merge, Gene Name: IDH1.