Hyaluronan synthase 1/HAS1 Antibody

• Catalog Number: orb526995
• Category: Antibodies
• Description: Hyaluronan synthase 1/HAS1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 70 kDa
• UniProt ID: Q92839
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Hyaluronan synthase 1; Hyaluronate synthase 1; Hya
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U-87MG cells using anti-HAS1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB:Lane 1:SHG-44 cell;2:THP-1 cell;3:rat brain tissue;4:rat smooth muscle tissue;5:rat ovary tissue;6:mouse brain tissue;7:mouse smooth muscle tissue;8:mouse ovary tissue;9:mouse small intestine tissue;10:mouse Neuro-2a cell.

IF analysis of HAS1 using anti-HAS1 antibody.HAS1 was detected in immunocytochemical section of U20S cell.

IF analysis of HAS1 using anti-HAS1 antibody.HAS1 was detected in immunocytochemical section of U20S cell.

IHC analysis of HAS1 using anti-HAS1 antibody.HAS1 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of HAS1 using anti-HAS1 antibody.HAS1 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of HAS1 using anti-HAS1 antibody.HAS1 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of HAS1 using anti-HAS1 antibody.HAS1 was detected in paraffin-embedded section of rat small intestine tissue.

IHC analysis of HAS1 using anti-HAS1 antibody.HAS1 was detected in paraffin-embedded section of mouse spleen tissue.