You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330624 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HYAL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HYAL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | HYAL1 |
UniProt ID | Q12794 |
Protein Sequence | Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY |
NCBI | NP_695014 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HYAL-1 antibody, anti LUCA1 antibody, anti MG Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human HepG2 tissue using HYAL1 antibody
Immunohistochemical staining of human Breast tissue using HYAL1 antibody
Immunohistochemical staining of human Liver tissue using HYAL1 antibody
Western blot analysis of human Fetal Lung tissue using HYAL1 antibody
Western blot analysis of human Fetal Brain tissue using HYAL1 antibody
Host: Rabbit, Target Name: HYAL1, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: HYAL1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: HYAL1, Positive control (+): HepG2 (HG), Negative control (-): Human Ovary (OV), Antibody concentration: 0.5 ug/ml.
HYAL1 antibody - N-terminal region (orb330624) validated by WB using HepG2 cell lysate at 1 ug/ml. HYAL1 is supported by BioGPS gene expression data to be expressed in HepG2.
Immunohistochemistry with breast cancer tissue tissue.
Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HYAL1 antibody (orb330624).
ELISA, FC, IF, IHC | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating