Cart summary

You have no items in your shopping cart.

    Human VEGFA protein

    Catalog Number: orb419318

    DispatchUsually dispatched within 1-2 weeks
    $ 3,300.00
    Catalog Numberorb419318
    CategoryProteins
    DescriptionRecombinant Human Vascular endothelial growth factor A active
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 97% as determined by SDS-PAGE and HPLC.
    MW19.3 kDa
    UniProt IDP15692
    Protein SequenceM+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
    Protein LengthPartial of Isoform 4
    SourceYeast
    Biological OriginHomo sapiens (Human)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml.
    Expression Region27-191aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
    Alternative namesVEGF-A, VPF
    Read more...
    NoteFor research use only
    Application notesTag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length
    Expiration Date6 months from date of receipt.
    Human VEGFA protein

    SDS-PAGE analysis of Human VEGFA protein

    • Human VEGF121 Protein [orb257918]

      Unconjugated

      95%

      14.1 kDa

      Human VEGF121 Protein, premium grade (orb257918) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 147 (Accession # P15692-9).

      1 mg, 50 μg, 20 μg
    • Human VEGF165 Protein [orb257924]

      Unconjugated

      90%

      21.1 kDa

      Human VEGF165, His Tag (orb257924) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 191 (Accession # P15692-4).

      1 mg, 50 μg
    • Human VEGF165 Protein [orb257923]

      Unconjugated

      95%

      19.2 kDa

      Human VEGF165, premium grade (orb257923) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 191 (Accession # P15692-4).

      1 mg, 50 μg, 20 μg
    • Human VEGF121 Protein [orb334936]

      Unconjugated

      95%

      14.9 kDa

      Human VEGF121, His Tag (orb334936) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 147 (Accession # P15692-9).

      1 mg, 50 μg
    • Mouse VEGF120 Protein [orb257917]

      Unconjugated

      95%

      14.1 kDa

      Mouse VEGF120 Protein, Tag Free (orb257917) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 146 (Accession # AAB22254.1 ).

      1 mg, 50 μg, 20 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars