You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419318 |
---|---|
Category | Proteins |
Description | Recombinant Human Vascular endothelial growth factor A active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
MW | 19.3 kDa |
UniProt ID | P15692 |
Protein Sequence | M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Protein Length | Partial of Isoform 4 |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml. |
Expression Region | 27-191aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20 |
Alternative names | VEGF-A, VPF Read more... |
Note | For research use only |
Application notes | Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human VEGFA protein
Unconjugated | |
95% | |
14.1 kDa | |
Human VEGF121 Protein, premium grade (orb257918) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 147 (Accession # P15692-9). |
Unconjugated | |
90% | |
21.1 kDa | |
Human VEGF165, His Tag (orb257924) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 191 (Accession # P15692-4). |
Unconjugated | |
95% | |
19.2 kDa | |
Human VEGF165, premium grade (orb257923) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 191 (Accession # P15692-4). |
Unconjugated | |
95% | |
14.9 kDa | |
Human VEGF121, His Tag (orb334936) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 147 (Accession # P15692-9). |
Unconjugated | |
95% | |
14.1 kDa | |
Mouse VEGF120 Protein, Tag Free (orb257917) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 146 (Accession # AAB22254.1 ). |
Filter by Rating