You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245335 |
---|---|
Category | Proteins |
Description | Human VEGF-D protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 40.1 kDa |
UniProt ID | O43915 |
Protein Sequence | FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 89-205aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | VEGF-D,, VEGFD, FIGF Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
13.4 kDa | |
Human VEGF-D, His Tag (orb257928) is expressed from human 293 cells (HEK293). It contains AA Phe 93 - Ser 201 (Accession # AAH27948). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
> 95% by SDS-PAGE. | |
KMP1636, Recombinant Human VEGF-D Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe93-Ser201) of human VEGF-D (Accession #O43915) fused with a 6×His Tag at the C-terminus. |
Filter by Rating