You have no items in your shopping cart.
Cart summary
Human VEGF-D protein
Catalog Number: orb245335
| Catalog Number | orb245335 |
|---|---|
| Category | Proteins |
| Description | Human VEGF-D protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 40.1 kDa |
| UniProt ID | O43915 |
| Protein Sequence | FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 89-205aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | VEGF-D,, VEGFD, FIGF Read more... |
| Note | For research use only |
| Application notes | This is GST-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human VEGF-D Protein [orb257928]
Unconjugated
95%
13.4 kDa
Human VEGF-D, His Tag (orb257928) is expressed from human 293 cells (HEK293). It contains AA Phe 93 - Ser 201 (Accession # AAH27948).
1 mg, 100 μg - Item 1 of 1
Human VEGFD Protein, hFc Tag [orb2321358]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 38.3 kDa after removal of the signal peptide. The apparent molecular mass of VEGFD-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg Human FIGF protein [orb391743]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant human VEGFD Protein,C-His (HEK293) [orb2328527]
> 85% as determined by SDS-PAGE
20 μg, 50 μg, 100 μg
