You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb429082 |
---|---|
Category | Tools |
Description | Recombinant of human UBE2L3 (His) protein |
Form/Appearance | Sterile Filtered white lyophilized powder. |
Purity | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD |
Source | Escherichia Coli |
Storage | Stability: Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
Buffer/Preservatives | Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. |
Alternative names | Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, U Read more... |
Note | For research use only |
Application notes | Enzymes |
Expiration Date | 12 months from date of receipt. |
> 95% by SDS-PAGE. | |
KMP1044, Recombinant Human UBE2L3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp154) of human UBE2L3 (Accession #NP_003338.1) fused with a 6×His Tag at the C-terminus. |
Filter by Rating