Human UBE2F protein

Catalog Number: orb54568

Catalog Number	orb54568
Category	Proteins
Description	Recombinant human UBE2F protein
Tag	N-terminal GST-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	48.1 kDa
UniProt ID	Q969M7
Protein Sequence	MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR
Protein Length	Full Length
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	1-185aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	NEDD8 carrier protein UBE2F NEDD8 protein ligase U Read more...
Note	For research use only
Application notes	N-terminal GST-tagged: N-terminal GST-tagged1-181AA: 1-185AAFull Length of Isoform 3: Full Length
Expiration Date	6 months from date of receipt.

UBE2F siRNA (Human) [orb1852942]
Applications:
RNA-I
Sizes Available: 30 nmol, 15 nmol
Human NEDD8-conjugating enzyme UBE2F Protein [orb1475582]
Sizes Available: 50 μg, 500 μg
Human UBE2F Protein [orb429073]
Purity:
Greater than 95% as determined by SDS-PAGE.
Source:
E.coli
Sizes Available: 5 μg, 1 mg, 20 μg
Human UBE2F Protein, His Tag [orb2700323]
Purity:
> 95%, determined by SDS-PAGE
Source:
This protein contains the human CRADD (P78560) (Met 1-Glu 199) was fused with a polyhistidine tag at the C-terminus and expressed from E. coli.
Sizes Available: 100 μg, 20 μg
Human UBE2F Protein, His Tag [orb2700324]
Purity:
> 94%, determined by SDS-PAGE
Source:
This protein contains the human UBE2F isoform 1 (Q969M7-1) (Met 1-Arg 185) was expressed with a polyhistide tag at the N-terminus and expressed from E. coli.
Sizes Available: 100 μg, 50 μg

Purity:	Greater than 95% as determined by SDS-PAGE.
Source:	E.coli

Purity:	> 95%, determined by SDS-PAGE
Source:	This protein contains the human CRADD (P78560) (Met 1-Glu 199) was fused with a polyhistidine tag at the C-terminus and expressed from E. coli.

Purity:	> 94%, determined by SDS-PAGE
Source:	This protein contains the human UBE2F isoform 1 (Q969M7-1) (Met 1-Arg 185) was expressed with a polyhistide tag at the N-terminus and expressed from E. coli.