You have no items in your shopping cart.
Cart summary
Human UBE2D4 protein
Catalog Number: orb54372
| Catalog Number | orb54372 |
|---|---|
| Category | Proteins |
| Description | Recombinant human UBE2D4 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 43.6 kDa |
| UniProt ID | Q9Y2X8 |
| Protein Sequence | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM |
| Protein Length | Full Length |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-147aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | E2 ubiquitin-conjugating enzyme D4 HBUCE1 Ubiquiti Read more... |
| Note | For research use only |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-361AA: 1-147AAFull Length : Full Length |
| Expiration Date | 6 months from date of receipt. |
Human UBE2D4 protein [orb392658]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
10 μg, 500 μg, 50 μgUBE2D4 Protein, Human, Recombinant (GST) [orb1960937]
98.00%
40 KDa (reducing condition)
1 mg, 500 μg, 50 μg, 10 μgHuman UBE2D4 Protein [orb429070]
Greater than 95% as determined by SDS-PAGE.
E.coli
5 μg, 20 μg, 1 mg
