You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594908 |
---|---|
Category | Proteins |
Description | Recombinant Human Thioredoxin(TXN) (Active) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 13.9 kDa |
UniProt ID | P10599 |
Protein Sequence | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
Protein Length | Full Length |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 1-105aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Alternative names | Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface Read more... |
Note | For research use only |
Application notes | Full Length |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Filter by Rating