Human TNFSF14 protein

Catalog Number: orb605256

Catalog Number	orb605256
Category	Proteins
Description	Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial
Tag	C-terminal hFc-Myc-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	48.3 kDa
UniProt ID	O43557
Protein Sequence	DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Protein Length	Partial
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Expression Region	74-240aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Herpes virus entry mediator ligand (HVEM-L) (Herpe Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide.
Source:	Mammalian

Sizes Available: 100 μg, 10 μg, 50 μg

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	46.7 kDa
Source:	Mammalian cell

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human TNFSF14(Leu59- Val240) was fused with the N-terminal His Tag and expressed in Mammalian cells.