You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594868 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 18.1 kDa |
UniProt ID | Q07011 |
Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml. |
Expression Region | 24-186aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137 Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
19.2 kDa | |
Cynomolgus / Rhesus macaque 4-1BB, His Tag (orb334873) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Gln 186 (Accession # XP_005544945.1). |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide. The apparent molecular mass of c4-1BB-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Human | |
7.8 pg/mL-500 pg/mL | |
1.95 pg/mL |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Filter by Rating