You have no items in your shopping cart.
Cart summary
Human TNFRSF9 protein
Catalog Number: orb594867
| Catalog Number | orb594867 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active) |
| Tag | C-terminal 6xHis-Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 44 kDa |
| UniProt ID | Q07011 |
| Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Protein Length | Extracellular Domain |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml. |
| Expression Region | 24-186aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | CD137;ILA;TNFRSF9;4-1BB ligand receptor;CDw137;T-c Read more... |
| Note | For research use only |
| Application notes | Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Cynomolgus / Rhesus macaque 4-1BB / TNFRSF9 Protein [orb334873]
Unconjugated
90%
19.2 kDa
Cynomolgus / Rhesus macaque 4-1BB, His Tag (orb334873) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Gln 186 (Accession # XP_005544945.1).
1 mg, 100 μg Cynomolgus 4-1BB Protein, hFc Tag [orb1826724]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide. The apparent molecular mass of c4-1BB-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgHuman TNFRSF9 ELISA Kit [orb340032]
Human
7.8 pg/mL-500 pg/mL
1.95 pg/mL
48 t, 24T, 10 x 96 t, 96 t, 5 x 96 tHuman TNFRSF9 protein [orb706831]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman TNFRSF9 protein [orb706832]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
