You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594878 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 21 kDa |
UniProt ID | P43489 |
Protein Sequence | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 25 ug/ml. |
Expression Region | 29-216aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
22.0 kDa | |
Human OX40 Protein, His Tag (orb257728) is expressed from human 293 cells (HEK293). It contains AA Leu 29 - Ala 216 (Accession # P43489-1). |
Unconjugated | |
90% | |
46.8 kDa | |
Human OX40, Fc Tag (orb257729) is expressed from human 293 cells (HEK293). It contains AA Leu 29 - Ala 216 (Accession # NP_003318). |
Unconjugated | |
95% | |
22.1 kDa | |
Cynomolgus / Rhesus macaque OX40, His Tag (orb257726) is expressed from human 293 cells (HEK293). It contains AA Lys 28 - Ala 214 (Accession # XP_001090870.1). |
Unconjugated | |
95% | |
46.9 kDa | |
Cynomolgus / Rhesus macaque OX40, Fc Tag (orb257727) is expressed from human 293 cells (HEK293). It contains AA Lys 28 - Ala 214 (Accession # XP_001090870.1). |
Unconjugated | |
90% | |
23.2 kDa | |
Mouse OX40, His Tag (orb257730) is expressed from human 293 cells (HEK293). It contains AA Val 20 - Pro 211 (Accession # P47741-1). |
Filter by Rating