Human TNFRSF4 protein

Catalog Number: orb594878

Catalog Number	orb594878
Category	Proteins
Description	Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial (Active)
Tag	C-terminal 6xHis-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	21 kDa
UniProt ID	P43489
Protein Sequence	LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Protein Length	Partial
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 25 ug/ml.
Expression Region	29-216aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alternative names	Tumor necrosis factor receptor superfamily member Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Item 1 of 2

Conjugation:	Unconjugated
Purity:	95%
MW:	22.1 kDa
Source:	Cynomolgus / Rhesus macaque OX40, His Tag (orb257726) is expressed from human 293 cells (HEK293). It contains AA Lys 28 - Ala 214 (Accession # XP_001090870.1).

Sizes Available: 1 mg, 100 μg

Item 1 of 2

Conjugation:	Unconjugated
Purity:	95%
MW:	46.9 kDa
Source:	Cynomolgus / Rhesus macaque OX40, Fc Tag (orb257727) is expressed from human 293 cells (HEK293). It contains AA Lys 28 - Ala 214 (Accession # XP_001090870.1).

Sizes Available: 1 mg, 100 μg