You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TNFRSF1B protein
Catalog Number: orb604426
| Catalog Number | orb604426 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 46.3 kDa |
| UniProt ID | P20333 |
| Protein Sequence | VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 27-203aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Tumor necrosis factor receptor 2 , TNF-R2Tumor nec Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 4
Human TNFRSF1B Protein, hFc Tag [orb1743387]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 51.3 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-hFc is approximately 55-70kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 3
Human TNFRSF1B protein [orb705337]
Greater than 95% as determined by SDS-PAGE.
54.1 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
- Item 1 of 2
Anti-TNF Receptor II/TNFRSF1B Antibody [orb865475]
ELISA, FC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
10 μg, 100 μg - Item 1 of 1
Human TNFRSF1B Protein, His Tag [orb1743294]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.0 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-His is approximately 35-55 kDa due to glycosylation.
E.coli
50 μg, 100 μg, 10 μg
