You have no items in your shopping cart.
Cart summary
Human TNFRSF1B protein
Catalog Number: orb594843
| Catalog Number | orb594843 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 26.2 kDa |
| UniProt ID | P20333 |
| Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD |
| Protein Length | Extracellular Domain |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit TNFa-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TNFa is less than 0.6 µg/mL. |
| Expression Region | 23-257aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
| Application notes | Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
Human TNFRSF1B Protein, His Tag [orb1743294]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.0 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-His is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman TNFRSF1B Protein, hFc Tag [orb1743387]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 51.3 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-hFc is approximately 55-70kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman TNFRSF1B protein [orb706823]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg- Item 1 of 1
Human sTNF RII protein [orb223834]
SDS-PAGE
Unconjugated
> 97% by SDS-PAGE and HPLC analyses
20.0 kDa
5 μg, 100 μg, 500 μg Human TNFRSF1B ELISA Kit [orb406725]
Human
31.25 pg/mL-2000 pg/mL
7.8 pg/mL
48 t, 24T, 10 x 96 t, 96 t, 5 x 96 t
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
