Human TNFRSF1A protein

• Catalog Number: orb605392
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 85% as determined by SDS-PAGE.
• MW: 22.7 kDa
• UniProt ID: P19438
• Protein Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
• Protein Length: Partial
• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Expression Region: 22-211aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Tumor necrosis factor receptor 1 (TNF-R1) (Tumor n
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.