Human TNFRSF1A protein

Catalog Number: orb605392

Catalog Number	orb605392
Category	Proteins
Description	Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial
Tag	C-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	22.7 kDa
UniProt ID	P19438
Protein Sequence	IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Protein Length	Partial
Source	Yeast
Biological Origin	Homo sapiens (Human)
Expression Region	22-211aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Tumor necrosis factor receptor 1 (TNF-R1) (Tumor n Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Item 1 of 1
Human TNFR1 ELISA Kit [orb219271]
Reactivity:
Human
Dynamic Range:
7.8 pg/ml - 500 pg/ml
Sensitivity:
1 pg/ml
Sizes Available: 96 Test
Item 1 of 2
Human TNFR1 / CD120a / TNFRSF1A Protein [orb257878]
Conjugation:
Unconjugated
Purity:
98%
MW:
47.9 kDa
Source:
Human TNFR1, Fc Tag (orb257878) is expressed from human 293 cells (HEK293). It contains AA Ile 22 - Thr 211 (Accession # NP_001056).
Sizes Available: 1 mg, 100 μg
TRADD siRNA (Human) [orb1862520]
Applications:
RNA-I
Sizes Available: 30 nmol, 15 nmol
Human TNFR1 ELISA Kit [orb340099]
Reactivity:
Human
Dynamic Range:
78.125 pg/mL-5000 pg/mL
Sensitivity:
65 pg/mL
Sizes Available: 48 t, 24T, 10 x 96 t, 96 t, 5 x 96 t

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 46.6 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1A-hFc is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Conjugation:	Unconjugated
Purity:	98%
MW:	47.9 kDa
Source:	Human TNFR1, Fc Tag (orb257878) is expressed from human 293 cells (HEK293). It contains AA Ile 22 - Thr 211 (Accession # NP_001056).