You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594847 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 10B(TNFRSF10B),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 15.19 kDa |
UniProt ID | O14763 |
Protein Sequence | ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TRAIL is less than 100 ng/ml. |
Expression Region | 56-182aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Tumor Necrosis Factor Receptor Superfamily Member Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
40.4 kDa | |
Human TRAIL R2, Fc Tag (orb257899) is expressed from human 293 cells (HEK293). It contains AA Ile 56 - Glu 182 (Accession # NP_003833). |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 40.3 kDa after removal of the signal peptide. The apparent molecular mass of mTNFRSF10B-hFc is approximately 40-55 kDa due to glycosylation. | |
Mammalian |
HPLC, SDS-PAGE | |
Unconjugated | |
> 97% by SDS-PAGE and HPLC analyses | |
14.8 kDa |
Unconjugated | |
95% | |
15.4 kDa | |
Human TRAIL R2, His Tag (orb257898) is expressed from human 293 cells (HEK293). It contains AA Ile 56 - Glu 182 (Accession # NP_003833). |
Filter by Rating