You have no items in your shopping cart.
Cart summary
Human TNFR2 Protein (His Tag)
Catalog Number: orb80625
| Catalog Number | orb80625 |
|---|---|
| Category | Proteins |
| Description | Recombinant of Human TNFR2 protein (His Tag) |
| Form/Appearance | Sterile Filtered clear solution. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
| Source | Escherichia Coli |
| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles |
| Buffer/Preservatives | TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol. |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
| Application notes | Cytokines And Growth Factors |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human TNFRSF1B Protein, His Tag [orb1743294]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.0 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-His is approximately 35-55 kDa due to glycosylation.
E.coli
50 μg, 100 μg, 10 μg - Item 1 of 1
Human TNFR2 Protein, His Tag [orb257880]
Unconjugated
95%
26.0 kDa
Human TNFR2, His Tag (orb257880) is expressed from human 293 cells (HEK293). It contains AA Leu 23 - Asp 257 (Accession # AAA36755).
1 mg, 50 μg TNFR2/CD120b/TNFR1B Protein, Human, Recombinant (His & Avi), Biotinylated [orb1953351]
98.00%
28.39 kDa (predicted); 44.42 kDa (reducing conditions)
100 μg, 20 μgHuman Tumor Necrosis Factor Receptor Superfamily Member 1B protein (C-His) [orb312061]
10 μg, 50 μg, 500 μg, 1 mg
