You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245328 |
---|---|
Category | Proteins |
Description | Recombinant human Metalloproteinase inhibitor 2 |
Reactivity | Human |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 48.5 kDa |
UniProt ID | P16035 |
Protein Sequence | SPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
Protein Length | Partial |
Source | E.coli |
Expression Region | 30-220aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | TIMP-2, TIMP2, CSC-21K Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
22.6 kDa | |
Human TIMP-2, His Tag (orb257870) is expressed from human 293 cells (HEK293). It contains AA Cys 27 - Pro 220 (Accession # NP_003246.1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC | |
KMP2120, Recombinant Human TIMP-2 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Cys27-Pro220) of Human TIMP-2 fused with a His Tag at the C-terminal. |
≥90% as determined by SDS-PAGE | |
This protein contains the human TIMP2(Cys27-Pro220) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
> 95% by SDS-PAGE. | |
KMP1276, Recombinant Human TIMP-2 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Cys27-Pro220) of human TIMP-2 (Accession #P16035) fused with a 6xHis Tag at the C- terminus. |
Filter by Rating