You have no items in your shopping cart.
Cart summary
Human TGFB2 protein
Catalog Number: orb594750
| Catalog Number | orb594750 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Transforming growth factor beta-2(TGFB2) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 12.7 kDa |
| UniProt ID | P61812 |
| Protein Sequence | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 15 ng/ml. |
| Expression Region | 303-414aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
| Alternative names | Transforming growth factor beta-2;TGFB2;Polyergin; Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
Human TGFB2 protein [orb392555]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman TGFB2 protein [orb418749]
Greater than 90% as determined by SDS-PAGE.
16.7 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human TGF-beta 2/TGFB2 Protein [orb1550874]
> 95% by SDS-PAGE.
KMP1615, Recombinant Human TGF-beta 2/TGFB2 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ala303-Ser414) of human TGF-beta 2/TGFB2 (Accession #P61812).
50 μg, 500 μgRecombinant Human TGF beta 2 Protein [orb1550362]
> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC
KMP2127, Recombinant Human TGF beta 2 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Arg303-Ser414) of Human TGF beta 2 fused with no tag .
100 μg, 500 μgRecombinant Human TGFB2 Protein, No Tag [orb1551560]
≥90% as determined by SDS-PAGE
This protein contains the human TGFB2(Ala303-Ser414) was fused without Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
