You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604408 |
---|---|
Category | Proteins |
Description | Recombinant Human Transforming growth factor beta-1(TGFB1),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 16.6 kDa |
UniProt ID | P01137 |
Protein Sequence | DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 281-390aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Cartilage-inducing factor, CED, Differentiation in Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Unconjugated | |
95% | |
12.8 kDa (monomer) | |
Human TGFB1, premium grade (orb257996) is expressed from human 293 cells (HEK293). It contains AA Ala 279 - Ser 390 (Accession # P01137-1). |
ICC, IF, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 52-60 kDa based on Tris-Bis PAGE result. |