You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594740 |
---|---|
Category | Proteins |
Description | Recombinant Human Transforming growth factor beta-1(TGFB1) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 12.8 kDa |
UniProt ID | P01137 |
Protein Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 4-40 pg/ml. |
Expression Region | 279-390aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 50mM Glycine-HCl, 150mMNacl, pH 2.5 |
Alternative names | Transforming Growth Factor Beta-1; TGF-Beta-1; Lat Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Unconjugated | |
95% | |
12.8 kDa (monomer) | |
Human TGFB1, premium grade (orb257996) is expressed from human 293 cells (HEK293). It contains AA Ala 279 - Ser 390 (Accession # P01137-1). |
ICC, IF, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 52-60 kDa based on Tris-Bis PAGE result. |