Human TGF beta 1 protein

Catalog Number: orb594740

Catalog Number	orb594740
Category	Proteins
Description	Recombinant Human Transforming growth factor beta-1(TGFB1) (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	12.8 kDa
UniProt ID	P01137
Protein Sequence	ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Protein Length	Partial
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 4-40 pg/ml.
Expression Region	279-390aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 50mM Glycine-HCl, 150mMNacl, pH 2.5
Alternative names	Transforming Growth Factor Beta-1; TGF-Beta-1; Lat Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Item 1 of 2

Conjugation:	Unconjugated
Purity:	95%
MW:	12.8 kDa (monomer)
Source:	Human TGFB1, premium grade (orb257996) is expressed from human 293 cells (HEK293). It contains AA Ala 279 - Ser 390 (Accession # P01137-1).

Sizes Available: 1 mg, 50 μg, 10 μg

Purity:	> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
MW:	Due to glycosylation, the protein migrates to 52-60 kDa based on Tris-Bis PAGE result. kDa