You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54315 |
---|---|
Category | Proteins |
Description | Recombinant human SUMO4 protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 37.7 kDa |
UniProt ID | Q6EEV6 |
Protein Sequence | MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY |
Protein Length | Full Length of BC130305 |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 1-95aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Ubiquitin-like protein which can be covalently att Read more... |
Note | For research use only |
Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-365AA: 1-95AAFull Length : Full Length of BC130305 |
Expiration Date | 6 months from date of receipt. |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
100.00% | |
20 KDa (reducing condition) |