You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358421 |
---|---|
Category | Proteins |
Description | Recombinant human SIGLEC15 protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 42.6 kDa |
UniProt ID | Q6ZMC9 |
Protein Sequence | FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST |
Protein Length | Extracellular Domain |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 20-263aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CD33 antigen-like 3 Read more... |
Note | For research use only |
Application notes | This is His-SUMO-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 53.6 kDa after removal of the signal peptide.The apparent molecular mass of SIGLEC15-mFc-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
30.6 kDa | |
Mammalian cell |
> 95% by SDS-PAGE. | |
KMP1820, Recombinant Human SIGLEC15 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (SIGLEC15(Phe20-Thr263)&mFc(Pro99-Lys330)) of human SIGLEC15 (Accession #) fused with a Fc and His Tag at the C-terminal. |
Filter by Rating