Human SIGLEC15 protein

Catalog Number: orb358421

Catalog Number	orb358421
Category	Proteins
Description	Recombinant human SIGLEC15 protein
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	42.6 kDa
UniProt ID	Q6ZMC9
Protein Sequence	FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Protein Length	Extracellular Domain
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	20-263aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	CD33 antigen-like 3 Read more...
Note	For research use only
Application notes	This is His-SUMO-tag protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 53.6 kDa after removal of the signal peptide.The apparent molecular mass of SIGLEC15-mFc-His is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Purity:	> 95% by SDS-PAGE.
Source:	KMP1820, Recombinant Human SIGLEC15 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (SIGLEC15(Phe20-Thr263)&mFc(Pro99-Lys330)) of human SIGLEC15 (Accession #) fused with a Fc and His Tag at the C-terminal.

Sizes Available: 50 μg, 100 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	30.6 kDa
Source:	Mammalian cell