Human RSPO1 protein

Catalog Number: orb594926

Catalog Number	orb594926
Category	Proteins
Description	Recombinant Human R-spondin-1(RSPO1),partial (Active)
Tag	C-terminal 6xHis-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	27.8 kDa
UniProt ID	Q2MKA7
Protein Sequence	SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Protein Length	Full Length of Mature Protein
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells.The ED50 for this effect is 1-5 ng/ml.
Expression Region	31-263aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alternative names	RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ409 Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 39.9 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-146)-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 100 μg, 10 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 27.6 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-263)-His is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	30.2 kDa
Source:	Mammalian cell

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells