You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359183 |
---|---|
Category | Proteins |
Description | Recombinant human PTN active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 96% as determined by SDSPAGE and HPLC. |
MW | 15.3 kDa |
UniProt ID | P21246 |
Protein Sequence | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been precoated with 100 µl/well of a solution of 510 µg/ml rHuPTN. |
Expression Region | 33-168aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4 |
Alternative names | PTN, HBBM, Heparin-binding growth factor 8, HBGF-8 Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human PTN protein (Active)
Filter by Rating