You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244466 |
---|---|
Category | Proteins |
Description | Recombinant human Prostate stem cell antigen |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 35.7kDa |
UniProt ID | O43653 |
Protein Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 12-86aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | PSCA, UNQ206, PRO232 Read more... |
Note | For research use only |
Application notes | Full length of GST-tag and expression region is 21-95a |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 34.5 kDa after removal of the signal peptide. The apparent molecular mass of mPSCA-hFc is approximately 40-55 kDa due to glycosylation. | |
Mammalian |
Greater than 85% as determined by SDS-PAGE. | |
14.2 kDa | |
E.coli |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 34.4 kDa after removal of the signal peptide.The apparent molecular mass of PSCA-hFc is approximately 40-57 kDa due to glycosylation. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
9.7 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
13.4 kDa | |
E.coli |
Filter by Rating