You have no items in your shopping cart.
Cart summary
Human PSCA protein
Catalog Number: orb244466
| Catalog Number | orb244466 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Prostate stem cell antigen |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 35.7kDa |
| UniProt ID | O43653 |
| Protein Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 12-86aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | PSCA, UNQ206, PRO232 Read more... |
| Note | For research use only |
| Application notes | Full length of GST-tag and expression region is 21-95a |
| Expiration Date | 6 months from date of receipt. |
Mouse PSCA Protein, hFc Tag [orb1290896]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.5 kDa after removal of the signal peptide. The apparent molecular mass of mPSCA-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman PSCA Protein [orb1477776]
Greater than 85% as determined by SDS-PAGE.
14.2 kDa
E.coli
20 μg, 100 μg, 1 mgHuman PSCA Protein, hFc Tag [orb689427]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.4 kDa after removal of the signal peptide.The apparent molecular mass of PSCA-hFc is approximately 40-57 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman PSCA protein [orb54171]
Greater than 90% as determined by SDS-PAGE.
9.7 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman PSCA protein [orb704587]
Greater than 90% as determined by SDS-PAGE.
13.4 kDa
E.coli
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
