You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419243 |
---|---|
Category | Proteins |
Description | Recombinant Human Prolactin receptor |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 71.9 kDa |
UniProt ID | P16471 |
Protein Sequence | QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH |
Protein Length | Full Length of Mature Protein |
Source | in vitro E.coli expression system |
Biological Origin | Homo sapiens (Human) |
Expression Region | 25-622aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | AI987712, CLONE SPM213, CPRLP, Delta 4-delta 7/11 Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 25-622aaSequence Info: Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
51.0 kDa | |
Human Prolactin R, Fc Tag (orb420091) is expressed from human 293 cells (HEK293). It contains AA Gln 25 - Asp 234 (Accession # P16471-1). |
Unconjugated | |
95% | |
26.3 kDa | |
Human Prolactin R, His Tag (orb420092) is expressed from human 293 cells (HEK293). It contains AA Gln 25 - Asp 234 (Accession # P16471-1). |
Unconjugated | |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 25.8 kDa after removal of the signal peptide. The apparent molecular mass of PRLR-His is approximately 25-35 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 50.5 kDa after removal of the signal peptide. The apparent molecular mass of PRLR-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Greater than 95% as determined by SDS-PAGE. | |
27.2 kDa | |
Mammalian cell |
Filter by Rating