Human PLGF protein

Catalog Number: orb419319

Catalog Number	orb419319
Category	Proteins
Description	Recombinant Human Placenta growth factor active
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	> 97% as determined by SDS-PAGE and HPLC.
MW	17.3 kDa
UniProt ID	P49763
Protein Sequence	LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Protein Length	Full Length of Mature Protein of Isoform 3
Source	E.Coli
Biological Origin	Homo sapiens (Human)
Biological Activity	Fully biologically active when compared to standard. The biologically active as determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50 ng/ml.
Expression Region	19-170aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
Alternative names	PlGF, Read more...
Note	For research use only
Application notes	Tag Info: NO-taggedExpression Region: 19-170aaSequence Info: Partial of Isoform VEGF165
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 43.5 kDa after removal of the signal peptide.The apparent molecular mass of PGF-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Conjugation:	Unconjugated
Purity:	95%
MW:	18.2 kDa
Source:	Human PLGF, His Tag (orb257774) is expressed from human 293 cells (HEK293). It contains AA Leu 19 - Arg 170 (Accession # NP_002623.2).