You have no items in your shopping cart.
Cart summary
Human PDGF B protein
Catalog Number: orb604302
| Catalog Number | orb604302 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Platelet-derived growth factor subunit B(PDGFB) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 14.3 kDa |
| UniProt ID | P01127 |
| Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 82-190aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | PDGF-2 (Platelet-derived growth factor B chain) (P Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
Human PDGF-BB Protein, His-Avi Tag [orb334919]
Unconjugated
95%
15.1 kDa
Unconjugated Human PDGF-BB, His, (orb334919) is expressed from E. coli cells. It contains AA Ser 82 - Thr 190 (Accession # P01127-1).
200 μg, 50 μg, 1 mg - Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293), Biotin conjugated [orb2328734]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293) [orb1516344]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result.
50 μg Human PDGFRB Protein [orb1477114]
Greater than 85% as determined by SDS-PAGE.
54.6 kDa
E.coli
1 mg, 20 μg, 100 μgHuman PDGF B protein [orb604301]
Greater than 85% as determined by SDS-PAGE.
28.3 kDa
E.coli
100 μg, 1 mg, 20 μg
