You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604302 |
---|---|
Category | Proteins |
Description | Recombinant Human Platelet-derived growth factor subunit B(PDGFB) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 14.3 kDa |
UniProt ID | P01127 |
Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 82-190aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | PDGF-2 (Platelet-derived growth factor B chain) (P Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
15.1 kDa | |
Unconjugated Human PDGF-BB, His, (orb334919) is expressed from E. coli cells. It contains AA Ser 82 - Thr 190 (Accession # P01127-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
SDS-PAGE | |
Unconjugated | |
> 97% by SDS-PAGE and HPLC analyses | |
24.8 kDa |
Greater than 85% as determined by SDS-PAGE. | |
54.6 kDa | |
E.coli |
Filter by Rating