You have no items in your shopping cart.
Cart summary
Human PDGF B protein
Catalog Number: orb594736
| Catalog Number | orb594736 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Platelet-derived growth factor subunit B(PDGFB) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 98% as determined by SDS-PAGE. |
| MW | 12.42 kDa |
| UniProt ID | P01127 |
| Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 5-20 ng/ml. |
| Expression Region | 82-190aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM NaAc-HAc, pH 4.5. |
| Alternative names | Platelet-Derived Growth Factor Subunit B; PDGF Sub Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
Human PDGF-BB Protein, His-Avi Tag [orb334919]
Unconjugated
95%
15.1 kDa
Unconjugated Human PDGF-BB, His, (orb334919) is expressed from E. coli cells. It contains AA Ser 82 - Thr 190 (Accession # P01127-1).
200 μg, 50 μg, 1 mg - Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293), Biotin conjugated [orb2328734]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293) [orb1516344]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result.
50 μg Human PDGFRB Protein [orb1477114]
Greater than 85% as determined by SDS-PAGE.
54.6 kDa
E.coli
1 mg, 20 μg, 100 μgHuman PDGF B protein [orb604301]
Greater than 85% as determined by SDS-PAGE.
28.3 kDa
E.coli
100 μg, 1 mg, 20 μg
