You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359148 |
---|---|
Category | Proteins |
Description | Recombinant human ONCM active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
MW | 23.7 kDa |
UniProt ID | P13725 |
Protein Sequence | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR |
Protein Length | Partial |
Source | E.Coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
Expression Region | 26-234aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4 |
Alternative names | OSM, Read more... |
Background | Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity). {ECO:0000250}. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human ONCM protein (Active)
> 97% as determined by SDS-PAGE and HPLC. | |
22.0 kDa | |
E.Coli |
> 95% as determined by SDS-PAGE and HPLC. | |
25.8 kDa | |
E.Coli |
Filter by Rating