You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604289 |
---|---|
Category | Proteins |
Description | Recombinant Human Neurotrophin-4(NTF4),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 17.9 kDa |
UniProt ID | P34130 |
Protein Sequence | VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 82-210aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Neurotrophin-5 , NT-5Neutrophic factor 4 Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
FA, HPLC, SDS-PAGE | |
Unconjugated | |
> 97.0% as determined by RP-HPLC and analysis by SDS-PAGE |
> 97% as determined by SDS-PAGE and HPLC. | |
14.1 kDa | |
E.Coli |
Unconjugated | |
95% | |
14.1 kDa | |
Human NT-4, Tag Free (orb1496255) is expressed from E. coli cells. It contains AA Gly 81 - Ala 210 (Accession # P34130-1). |
Filter by Rating