You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1474960 |
---|---|
Category | Proteins |
Description | N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion and filling pressure and is involved in maintaining intravascular volume homeostasis. Elevated plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage |
Tested applications | ELISA, WB |
Reactivity | Human |
Tag | N-terminal 6xHis |
Form/Appearance | Lyophilized at 1 mg/mL in PBS |
Purity | > 95% |
MW | 12.6 KDa |
Protein Sequence | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNH LQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
Source | E.coli |
Endotoxins | < 0.2 EU/ug |
Storage | Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. Avoid repeated freezing/thawing cycles |
Buffer/Preservatives | Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely |
Alternative names | natriuretic peptide Precursor Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
BCA to determine the quantity of the protein. SDS PAGE to determine the purity of the protein.
≥90% as determined by SDS-PAGE | |
This protein contains the human NPPB(His27-Arg102) was fused with the N-terminal His Flag Tag and expressed in E. coli. |
> 95% as determined by SDS-PAGE | |
10 kDa |
> 90% as determined by SDS-PAGE | |
14 kDa |
Filter by Rating