Human NT-proBNP Protein

Catalog Number: orb1474960

Catalog Number	orb1474960
Category	Proteins
Description	N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion and filling pressure and is involved in maintaining intravascular volume homeostasis. Elevated plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage
Tested applications	ELISA, WB
Reactivity	Human
Tag	N-terminal 6xHis
Form/Appearance	Lyophilized at 1 mg/mL in PBS
Purity	> 95%
MW	12.6 KDa
Protein Sequence	MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNH LQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
Source	E.coli
Endotoxins	< 0.2 EU/ug
Storage	Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. Avoid repeated freezing/thawing cycles
Buffer/Preservatives	Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely
Alternative names	natriuretic peptide Precursor Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.

BCA to determine the quantity of the protein. SDS PAGE to determine the purity of the protein.

Recombinant Human NT-proBNP/NPPB Protein, His & Flag Tag [orb1551932]
Purity:
≥90% as determined by SDS-PAGE
Source:
This protein contains the human NPPB(His27-Arg102) was fused with the N-terminal His Flag Tag and expressed in E. coli.
Sizes Available: 100 μg, 50 μg
Recombinant human NT-proBNP protein [orb1974323]
Purity:
> 95% as determined by SDS-PAGE
Sizes Available: 100 μg
Human NT-proBNP Protein [orb1516896]
Purity:
> 95% as determined by SDS-PAGE
MW:
10 kDa
Human NT-proBNP Protein [orb1516611]
Purity:
> 90% as determined by SDS-PAGE
MW:
14 kDa
NT-proBNP Protein [orb1471928]
Sizes Available: 10 μg, 1 mg, 50 μg

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human NPPB(His27-Arg102) was fused with the N-terminal His Flag Tag and expressed in E. coli.

Purity:	> 90% as determined by SDS-PAGE
MW:	14 kDa