You have no items in your shopping cart.
Cart summary
Human NGF protein
Catalog Number: orb594731
| Catalog Number | orb594731 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Beta-nerve growth factor(NGF) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 13.4 kDa |
| UniProt ID | P01138 |
| Protein Sequence | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 2 ng/ml. |
| Expression Region | 122-241aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, pH 7.4. |
| Alternative names | Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
Human NGF Protein [orb1476758]
Greater than 90% as determined by SDS-PAGE.
20.9 kDa
E.coli
20 μg, 100 μg, 1 mgHuman KLK4 ELISA Kit [orb404683]
Human
0.156 ng/mL-10 ng/mL
0.039 ng/mL
10 x 96 t, 5 x 96 t, 96 t, 48 t, 24THuman NGF protein [orb392183]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
