Human NECTIN2 protein

Catalog Number: orb594862

Catalog Number	orb594862
Category	Proteins
Description	Recombinant Human Nectin-2(NECTIN2),partial (Active)
Tag	C-terminal 6xHis-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	36.58 kDa
UniProt ID	Q92692
Protein Sequence	QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Protein Length	Extracellular Domain
Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	The ED50 as determined by its ability to bind Human DNAM-1 in functional ELISA is less than 10 ug/ml.
Expression Region	32-360aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alternative names	Poliovirus Receptor-Related Protein 2; Herpes Viru Read more...
Note	For research use only
Application notes	Extracellular Domain
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 36.1 kDa after removal of the signal peptide.The apparent molecular mass of CD112-His is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 100 μg, 10 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 61.4 kDa after removal of the signal peptide.The apparent molecular mass of CD112-mFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 61.4 kDa after removal of the signal peptide.The apparent molecular mass of CD112-hFc is approximately 70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 100 μg, 50 μg