Human MOG protein

Catalog Number: orb604902

Catalog Number	orb604902
Category	Proteins
Description	Recombinant Human Myelin-oligodendrocyte glycoprotein(MOG),partial
Tag	N-terminal 10xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	17.9 kDa
UniProt ID	Q16653
Protein Sequence	GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Protein Length	Partial
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	30-154aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	BTN6, BTNL11, MGC26137, MOG alpha 5, MOG alpha 6, Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1255, Recombinant Human MOG Protein is produced by E.coli expression system. The target protein is expressed with sequence (Gly30-Gly154) of human MOG (Accession #Q16653) fused with a 6xHis Tag at the C- terminus.

Sizes Available: 500 μg, 50 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human MOG(Gly30-Gly154) was fused with the C-terminal His Tag and expressed in Mammalian cells.