You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb427131 |
---|---|
Category | Tools |
Description | Recombinant of human MIP 5 protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Purity | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
Source | Escherichia Coli |
Biological Activity | Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. |
Storage | Stability: Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
Buffer/Preservatives | MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl. |
Alternative names | Small inducible cytokine A15 precursor, CCL15, Mac Read more... |
Note | For research use only |
Application notes | Chemokines |
Expiration Date | 12 months from date of receipt. |
> 98% as determined by SDS-PAGE and HPLC. | |
7.4 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
10.2 kDa | |
E.Coli |
Human | |
3.12 pg/mL-200 pg/mL | |
7.81 pg/mL |
Filter by Rating