You have no items in your shopping cart.
Cart summary
Human MICA protein
Catalog Number: orb594909
| Catalog Number | orb594909 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human MHC class I polypeptide-related sequence A(MICA),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 59.9 kDa |
| UniProt ID | Q29983 |
| Protein Sequence | AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to bind Human N2DL2 in functional ELISA is less than 5 ug/ml. |
| Expression Region | 23-308aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | MHC Class I Polypeptide-Related Sequence A; MIC-A; Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
Human MICAa3 Protein, His Tag [orb1826752]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 12.5 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μgHuman MICAa3 Protein, mFc Tag [orb1826753]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 37.9 kDa after removal of the signal peptide. The apparent molecular mass of MICAa3(203-306)-mFc is approximately 35-70 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μg- Item 1 of 1
Human MHC class chain-related gene A protein [orb80176]
FA, HPLC, SDS-PAGE
Unconjugated
> 95.0% as determined by RP-HPLC and analysis by SDS-PAGE
10 μg, 500 μg, 100 μg Human MICA ELISA Kit [orb407592]
Human
1.56 ng/mL-100 ng/mL
0.39 ng/mL
10 x 96 t, 5 x 96 t, 96 t, 48 t, 24THuman MICA protein [orb392138]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
