Human MHC class chain-related gene A protein

• Catalog Number: orb80176
• Category: Proteins
• Description: MICA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 Gln308) The MICA is purified by proprietary chromatographic techniques.
• Tested applications: FA, HPLC, SDS-PAGE
• Purity: > 95.0% as determined by RP-HPLC and analysis by SDS-PAGE
• Conjugation: Unconjugated
• Target: MICA
• Solubility (25°C): It is recommended to reconstitute the lyophilized MICA in sterile H₂O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH.
• Biological Origin: E.coli
• Biological Activity: Measured by its ability to bind MICA antibody in ELISA.
• Storage: Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
• Buffer/Preservatives: Lyophilized from concentrated (1mg/ml) solution containing no additives.
• Alternative names: MHC class polypeptide-related sequence A protein,
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Human MHC class chain-related gene A protein