You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb80176 |
---|---|
Category | Proteins |
Description | MICA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 Gln308) The MICA is purified by proprietary chromatographic techniques. |
Tested applications | FA, HPLC, SDS-PAGE |
Purity | > 95.0% as determined by RP-HPLC and analysis by SDS-PAGE |
Conjugation | Unconjugated |
Target | MICA |
Solubility (25°C) | It is recommended to reconstitute the lyophilized MICA in sterile H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH. |
Biological Origin | E.coli |
Biological Activity | Measured by its ability to bind MICA antibody in ELISA. |
Storage | Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles. |
Buffer/Preservatives | Lyophilized from concentrated (1mg/ml) solution containing no additives. |
Alternative names | MHC class polypeptide-related sequence A protein, Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human MHC class chain-related gene A protein
Human | |
1.56 ng/mL-100 ng/mL | |
0.39 ng/mL |
FA, HPLC, SDS-PAGE | |
Unconjugated | |
> 95.0% as determined by RP-HPLC and analysis by SDS-PAGE |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
31.1 kDa | |
E.Coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
31 kDa | |
E.Coli |
Filter by Rating