You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb427053 |
---|---|
Category | Tools |
Description | Recombinant of human ME2 protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Purity | Greater than 95.0% as determined by(a) Analysis by HPLC.(b) Analysis by SDS-PAGE. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized ME2 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITEHHHHHH |
Source | Escherichia Coli |
Storage | Stability: Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles |
Buffer/Preservatives | The protein was Lyophilized from a 0.2µm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH 8.0. |
Alternative names | Malic enzyme 2 NAD(+)-dependent mitochondrial, NAD Read more... |
Note | For research use only |
Application notes | Enzymes |
Expiration Date | 12 months from date of receipt. |
The human full length CELR1 protein has a MW of 329.5kDa | |
Mammalian |
SDS-PAGE | |
Unconjugated | |
> 95% by SDS-PAGE and HPLC analyses. | |
64.4 kDa | |
E. coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
62.2 kDa | |
E.Coli |
Filter by Rating