You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494953 |
---|---|
Category | Proteins |
Description | CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids. |
Protein Sequence | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Source | Escherichia coli. |
Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of >1 x 104 IU/mg. |
Endotoxins | Less than 1EU/mg of rHuMCP-4/CCL13 as determined by LAL method. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Buffer/Preservatives | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating