You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244910 |
---|---|
Category | Proteins |
Description | Recombinant human Killer cell lectin-like receptor subfamily G member 1 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 31.5 kDa |
UniProt ID | Q96E93 |
Protein Sequence | LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF |
Protein Length | Extracellular Domain |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 60-195aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | KLRG1 Read more... |
Note | For research use only |
Application notes | This is His-SUMO-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 41.6 kDa after removal of the signal peptide.The apparent molecular mass of hFc-KLRG1 is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
95% | |
17.1 kDa | |
Mouse KLRG1, His Tag (orb1184763) is expressed from human 293 cells (HEK293). It contains AA Gln 57 - Tyr 188 (Accession # O88713-1). |
Unconjugated | |
90% | |
17.4 kDa | |
Human KLRG1, His Tag (orb1184764) is expressed from human 293 cells (HEK293). It contains AA Leu 60 - Phe 195 (Accession # Q96E93-1). |
Unconjugated | |
90% | |
16.8 kDa | |
Cynomolgus KLRG1 Protein, His Tag (orb1743036) is expressed from human 293 cells (HEK293). It contains AA Leu 60 - Pro 189 (Accession # A0A2K5WAP9). |
Unconjugated | |
90% | |
41.3 kDa | |
Cynomolgus KLRG1 Protein, Fc Tag (orb1743035) is expressed from human 293 cells (HEK293). It contains AA Leu 60 - Pro 189 (Accession # A0A2K5WAP9). |
Filter by Rating