You have no items in your shopping cart.
Cart summary
Human KITLG protein
Catalog Number: orb594742
| Catalog Number | orb594742 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Kit ligand(KITLG),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 22 kDa |
| UniProt ID | P21583 |
| Protein Sequence | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 15 ng/ml. |
| Expression Region | 26-214aa |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alternative names | Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cel Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
Mouse SCF / KITLG Protein [orb257825]
Unconjugated
95%
19.5 kDa
Mouse SCF, His Tag (orb257825) is expressed from human 293 cells (HEK293). It contains AA Lys 26 - Ala 189 (Accession # NP_038626).
50 μg, 20 μg, 1 mg - Item 1 of 1
Human SCF / KITLG (26-189) Protein [orb1496171]
Unconjugated
95%
18.5 kDa
Human SCF (26-189), premium grade (orb1496171) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ala 189 (Accession # P21583-1).
1 mg, 50 μg, 20 μg - Item 1 of 1
Human SCF Protein, His Tag (MALS verified) [orb1743048]
Unconjugated
90%
20.3 kDa
Human SCF, His Tag (orb1743048) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ala 189 (Accession # P21583-1).
100 μg, 1 mg Human KITLG protein [orb392027]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgHuman KITLG protein [orb392028]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
